Structure of PDB 6zm6 Chain e Binding Site BS01

Receptor Information
>6zm6 Chain e (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYSDHELRA
LDENQRLAKKQDILLAQDLEDMWEQKFLQFKLGARITEADEKNDRTSLNR
KLDRNLVLLVREKFGDQDVWILPQAEWQPGETLRGTAERTLATLSENNME
AKFLGNAPCGHYTFKFPQAMRTESNLGAKVFFFKALLLTGDFSQAGNKGH
HVWVTKDELGDYLKPKYLAQVRRFVSDL
Ligand information
>6zm6 Chain B (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaguguagcuuaacacaaagcacccaacuuacacuuaggagauuucaa
cuuaacuugaccgcucugacca
<<<<<<...<<<........>>>.<<.<<.......>>.>>.....<<<<
......>>>>..>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zm6 Mechanism of membrane-tethered mitochondrial protein synthesis.
Resolution2.59 Å
Binding residue
(original residue number in PDB)		F165 Q175 F215 K216 P218 Q219
Binding residue
(residue number reindexed from 1)		F114 Q124 F164 K165 P167 Q168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0008150 biological_process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0030054 cell junction
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zm6, PDBe:6zm6, PDBj:6zm6
PDBsum6zm6
PubMed33602856
UniProtQ9H2W6|RM46_HUMAN Large ribosomal subunit protein mL46 (Gene Name=MRPL46)

[Back to BioLiP]