Structure of PDB 6kac Chain e Binding Site BS01

Receptor Information
>6kac Chain e (length=76) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYF
TEDRQEAPLITDRFNALEQVKKLSGN
Ligand information
>6kac Chain u (length=24) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VTLALDKDDPAKEDSVKGLRKDIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kac Structural insight into light harvesting for photosystem II in green algae.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T67 D68 N71 K78
Binding residue
(residue number reindexed from 1)		T61 D62 N65 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kac, PDBe:6kac, PDBj:6kac
PDBsum6kac
PubMed31768031
UniProtP48268|PSBE_CHLRE Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]