Structure of PDB 6a5t Chain e Binding Site BS01

Receptor Information
>6a5t Chain e (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA
IGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>6a5t Chain T (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattacacccaagacaccaggcacga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a5t Structural basis of the nucleosome transition during RNA polymerase II passage.
Resolution6.7 Å
Binding residue
(original residue number in PDB)		R40 Y41 R49 L65 R69
Binding residue
(residue number reindexed from 1)		R2 Y3 R11 L27 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001556 oocyte maturation
GO:0001649 osteoblast differentiation
GO:0006334 nucleosome assembly
GO:0006997 nucleus organization
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0007566 embryo implantation
GO:0008283 cell population proliferation
GO:0008584 male gonad development
GO:0030307 positive regulation of cell growth
GO:0031508 pericentric heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0032200 telomere organization
GO:0035264 multicellular organism growth
GO:0042692 muscle cell differentiation
GO:0048477 oogenesis
GO:0090230 regulation of centromere complex assembly
GO:1902340 negative regulation of chromosome condensation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000939 inner kinetochore
GO:0001740 Barr body
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6a5t, PDBe:6a5t, PDBj:6a5t
PDBsum6a5t
PubMed30287617
UniProtP84243|H33_HUMAN Histone H3.3 (Gene Name=H3-3A)

[Back to BioLiP]