Structure of PDB 5gm6 Chain e Binding Site BS01

Receptor Information
>5gm6 Chain e (length=149) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFY
NQGDAQYAIKIMNRLIKVRQVTNSTGTAKLFIKNLADSIDSDQLVKIFNK
FGKLPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDY
Ligand information
>5gm6 Chain M (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaaaaaaaaaaaaaaacuagauacuaacacauuuaauuuuuuuuuguu
..................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y12 Y40 D43 K44 Y52 F54 G91 T92 F111 K113 K149 Y152 Y154
Binding residue
(residue number reindexed from 1)		Y4 Y32 D35 K36 Y44 F46 G76 T77 F81 K83 K116 Y119 Y121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ99181|HSH49_YEAST Protein HSH49 (Gene Name=HSH49)

[Back to BioLiP]