Structure of PDB 5dkp Chain e Binding Site BS01

Receptor Information
>5dkp Chain e (length=191) Species: 122586 (Neisseria meningitidis MC58) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLE
SENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAF
LLSAGEKGKRFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKL
NRLMAKHCDRDLADLERDTDRDNFMSAEEAKEYGLIDQILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dkp Development and Characterization of Potent Cyclic Acyldepsipeptide Analogues with Increased Antimicrobial Activity.
Resolution2.381 Å
Binding residue
(original residue number in PDB)		L28 F65 Y67 L95 F117 L196
Binding residue
(residue number reindexed from 1)		L22 F59 Y61 L89 F111 L190
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dkp, PDBe:5dkp, PDBj:5dkp
PDBsum5dkp
PubMed26818454
UniProtQ9JZ38|CLPP_NEIMB ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]