Structure of PDB 4dx9 Chain e Binding Site BS01

Receptor Information
>4dx9 Chain e (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CAEFRIKYVGAIEEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGI
KVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSL
WVYQCNSLEQAQAICKVLSTAFDSVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dx9 Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
I89 I138 I139 R140 M141 V142 C143 C184 F191
Binding residue
(residue number reindexed from 1)
I20 I69 I70 R71 M72 V73 C74 C115 F122
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4dx9, PDBe:4dx9, PDBj:4dx9
PDBsum4dx9
PubMed23317506
UniProtO14713|ITBP1_HUMAN Integrin beta-1-binding protein 1 (Gene Name=ITGB1BP1)

[Back to BioLiP]