Structure of PDB 8h2i Chain dg Binding Site BS01

Receptor Information
>8h2i Chain dg (length=32) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPLNDPIMIRTMIVYGNLSATYFTGNGAALTQ
Ligand information
>8h2i Chain di (length=29) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PLNDPIMIRTMIVYGNLSATYFTGNGAAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h2i Near-atomic, non-icosahedrally averaged structure of giant virus Paramecium bursaria chlorella virus 1.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		I14 M17 I18 V19 Y20 N22 L23 S24 A25 T26 Y27 F28 G30 N31 A33 A34 L35 T36
Binding residue
(residue number reindexed from 1)		I9 M12 I13 V14 Y15 N17 L18 S19 A20 T21 Y22 F23 G25 N26 A28 A29 L30 T31
Enzymatic activity
Enzyme Commision number ?
External links