Structure of PDB 4yuu Chain d1 Binding Site BS01

Receptor Information
>4yuu Chain d1 (length=339) Species: 2771 (Cyanidium caldarium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WFDLLDDWLKRDRFVFIGWSGILLFPCAYLALGAWFTGTTFVSSWYTHGL
ASSYLEGCNFLTAAVSSPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWTF
TALHGSFGLIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLLYPLG
QASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAI
HGATVENTLFEDGEASDTFRAFTPTQSEETYSMVTANRFWSQIFGVAFAN
KRWLHFFLLFVPVTGLWVSSIGIVGLALNLRAYDFVSQEIRAAEDPEFET
FYTKNILLNEGIRAWMAAQDQPHENFVFPEEVLPRGNAL
Ligand information
>4yuu Chain f1 (length=29) Species: 2771 (Cyanidium caldarium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TFRWLAIHGLAIPTVFFFGAITAMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Resolution2.77 Å
Binding residue
(original residue number in PDB)		Y42 T50 T53 F54 Y67 L68
Binding residue
(residue number reindexed from 1)		Y29 T37 T40 F41 Y54 L55
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TM47|PSBD_CYACA Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]