Structure of PDB 8wk4 Chain d Binding Site BS01

Receptor Information
>8wk4 Chain d (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT
EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT
KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK
RGDTLNVVNSPFSA
Ligand information
>8wk4 Chain i (length=19) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AIQGIEGVISQLQATAMAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wk4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
E276 T278 I372
Binding residue
(residue number reindexed from 1)
E48 T50 I97
External links
PDB RCSB:8wk4, PDBe:8wk4, PDBj:8wk4
PDBsum8wk4
PubMed
UniProtP15928|FLIF_SALTY Flagellar M-ring protein (Gene Name=fliF)

[Back to BioLiP]