Structure of PDB 8tof Chain d Binding Site BS01

Receptor Information

>8tof Chain d (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Ligand information

>8tof Chain H (length=5) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AARAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8tof Structure of the complete Saccharomyces cerevisiae Rpd3S-nucleosome complex.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	L103 H106
Binding residue (residue number reindexed from 1)	L76 H79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8tof, PDBe:8tof, PDBj:8tof
PDBsum	8tof
PubMed	38065958
UniProt	P02281\|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]