Structure of PDB 8ibf Chain d Binding Site BS01

Receptor Information
>8ibf Chain d (length=120) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRM
RPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPED
FPEKEKKTYAEILEPFHPVR
Ligand information
>8ibf Chain X (length=27) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPEPNPVIEGDLKPAKHGTRFFFWTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ibf Respiratory complex Membrane domain of CI, focus-refined of type II, Wild type mouse under cold temperature
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E17 L21 P22 R30 Y81 Y83 D87 H88
Binding residue
(residue number reindexed from 1)		E17 L21 P22 R30 Y81 Y83 D87 H88
External links
PDB RCSB:8ibf, PDBe:8ibf, PDBj:8ibf
PDBsum8ibf
PubMed
UniProtQ9CQ54|NDUC2_MOUSE NADH dehydrogenase [ubiquinone] 1 subunit C2 (Gene Name=Ndufc2)

[Back to BioLiP]