Structure of PDB 8ib6 Chain d Binding Site BS01

Receptor Information
>8ib6 Chain d (length=119) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMR
PVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDF
PEKEKKTYAEILEPFHPVR
Ligand information
>8ib6 Chain X (length=27) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPEPNPVIEGDLKPAKHGTRFFFWTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ib6 Respiratory complex Membrane domain of CI, focus-refined of type IA, Wild type mouse under cold temperature
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E17 L21 P22 Y81 D87 H88
Binding residue
(residue number reindexed from 1)		E16 L20 P21 Y80 D86 H87
External links
PDB RCSB:8ib6, PDBe:8ib6, PDBj:8ib6
PDBsum8ib6
PubMed
UniProtQ9CQ54|NDUC2_MOUSE NADH dehydrogenase [ubiquinone] 1 subunit C2 (Gene Name=Ndufc2)

[Back to BioLiP]