Structure of PDB 7oui Chain d Binding Site BS01

Receptor Information
>7oui Chain d (length=342) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYT
HGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGL
WAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIY
PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALL
CAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVA
FSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPE
FETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Ligand information
>7oui Chain f (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVRWLAVHGLAVPTVSFLGSISAMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		F28 Y43 F50 T51 T54 F55 Y68 L69
Binding residue
(residue number reindexed from 1)		F17 Y32 F39 T40 T43 F44 Y57 L58
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum7oui
PubMed34330992
UniProtP56761|PSBD_ARATH Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]