Structure of PDB 7bl4 Chain d Binding Site BS01

Receptor Information

>7bl4 Chain d (length=47) Species: 83333 (Escherichia coli K-12)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGK

Ligand information

>7bl4 Chain B (length=119)

ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggca

.<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7bl4 Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): K2 H6
• Binding residue (residue number reindexed from 1): K2 H6

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7bl4, PDBe:7bl4, PDBj:7bl4
• PDBsum: 7bl4
• PubMed: 33639093
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)