Structure of PDB 6qx2 Chain d Binding Site BS01

Receptor Information

>6qx2 Chain d (length=181) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEK
ARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHI
RTLLLTFFYRFMRPLIEAGYVYIAQPPTGMNADQLWETTMNPEHRALLQV
KLEDAIEADQTFEMLMGDVVENRRQFIEDNA

Ligand information

>6qx2 Chain e (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagcgtacggccgtacgctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qx2 Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	K460 L462 N463 K466 H515 V626 R629
Binding residue (residue number reindexed from 1)	K44 L46 N47 K50 H99 V170 R173

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6qx2, PDBe:6qx2, PDBj:6qx2
PDBsum	6qx2
PubMed	30962087
UniProt	P0A0K8\|GYRB_STAAU DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]