Structure of PDB 5cdw Chain d Binding Site BS01

Receptor Information
>5cdw Chain d (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGND
VQHFKVLRDGAGKYFLGVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cdw Structural and biophysical investigation of the interaction of a mutant Grb2 SH2 domain (W121G) with its cognate phosphopeptide.
Resolution2.602 Å
Binding residue
(original residue number in PDB)
R15 R34 S36 E37 S38 S44 H55 F56 K57 G69
Binding residue
(residue number reindexed from 1)
R13 R32 S34 E35 S36 S42 H53 F54 K55 G67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5cdw, PDBe:5cdw, PDBj:5cdw
PDBsum5cdw
PubMed26645482
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]