Structure of PDB 8ow1 Chain c Binding Site BS01

Receptor Information

>8ow1 Chain c (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNI

Ligand information

>8ow1 Chain D (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ataagtcacatggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaatattagtgta
tttgatttccgaaagttaaaaaagaaatagtaagaaatatatatttcatt
gaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	Q17 R44
Binding residue (residue number reindexed from 1)	Q1 R28

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ow1, PDBe:8ow1, PDBj:8ow1
PDBsum	8ow1
PubMed	37506202
UniProt	P04911\|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)

[Back to BioLiP]