Structure of PDB 8f1f Chain c Binding Site BS01

Receptor Information
>8f1f Chain c (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQL
EDGRTLSDYNIQKESTLHLVLRLRGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f1f Mechanism of selective recognition of Lys48-linked polyubiquitin by macrocyclic peptide inhibitors of proteasomal degradation
Resolution1.85 Å
Binding residue
(original residue number in PDB)
V70 L71 L73
Binding residue
(residue number reindexed from 1)
V70 L71 L73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8f1f, PDBe:8f1f, PDBj:8f1f
PDBsum8f1f
PubMed37938554
UniProtP0CG47|UBB_HUMAN Polyubiquitin-B (Gene Name=UBB)

[Back to BioLiP]