Structure of PDB 7zwd Chain c Binding Site BS01

Receptor Information
>7zwd Chain c (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSYMGHF
MKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELLVTKWKNWEKALLRKS
VVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEKEIQDI
NQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQ
EWSREEEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQHNKALK
RKEWTEEEDRMLTQLVQEMRVGSHIPYRRIVYYMEGRDSMQLIYRWTKSL
DPG
Ligand information
>7zwd Chain N (length=66) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccatcagtgtactaggacccgaaaattgagttacagaagtaactggtata
ctctggtttctcttca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zwd Structural basis of SNAPc-dependent snRNA transcription initiation by RNA polymerase II.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T182 K185 W187 K347 Y389
Binding residue
(residue number reindexed from 1)		T87 K90 W92 K252 Y294
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0042795 snRNA transcription by RNA polymerase II
GO:0042796 snRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0019185 snRNA-activating protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zwd, PDBe:7zwd, PDBj:7zwd
PDBsum7zwd
PubMed36424526
UniProtQ5SXM2|SNPC4_HUMAN snRNA-activating protein complex subunit 4 (Gene Name=SNAPC4)

[Back to BioLiP]