Structure of PDB 7t3k Chain c Binding Site BS01

Receptor Information
>7t3k Chain c (length=187) Species: 286 (Pseudomonas) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDES
RSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQV
SRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQS
TGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Ligand information
>7t3k Chain m (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaagaaauucacggcgggcuugauguccgcgucuaccugauucacugcc
guauaggcagc
.............................................<<<<<
.....>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t3k Structural basis of AcrIF24 as an anti-CRISPR protein and transcriptional suppressor.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		E14 P16 A18 Q19 H29 R102 Q104 S107 N108 R111 L112 R114 R115 R119 H120 R130 I131 L139 F143 V144 T145 S148 S150 T151 Q153 H154 F155 R156 F158 C175 Y176
Binding residue
(residue number reindexed from 1)		E14 P16 A18 Q19 H29 R102 Q104 S107 N108 R111 L112 R114 R115 R119 H120 R130 I131 L139 F143 V144 T145 S148 S150 T151 Q153 H154 F155 R156 F158 C175 Y176
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7t3k, PDBe:7t3k, PDBj:7t3k
PDBsum7t3k
PubMed36163386
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]