Structure of PDB 7pfw Chain c Binding Site BS01

Receptor Information

>7pfw Chain c (length=109) Species: 9606 (Homo sapiens)

ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
NIQAVLLPK

Ligand information

>7pfw Chain J (length=167)

acttacatgcacaggatgtatatatgtgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctccagtggccagtgg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7pfw Histone H1 binding to nucleosome arrays depends on linker DNA length and trajectory.
• Resolution: 5.2 Å
• Binding residue (original residue number in PDB): R11 R29 R42 V43 G44 A45 K75 T76 R77
• Binding residue (residue number reindexed from 1): R2 R20 R33 V34 G35 A36 K66 T67 R68

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7pfw, PDBe:7pfw, PDBj:7pfw
• PDBsum: 7pfw
• PubMed: 35581345
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)