Structure of PDB 7e82 Chain c Binding Site BS01

Receptor Information
>7e82 Chain c (length=249) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSL
ATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTR
NGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDP
PNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRI
MSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSM
Ligand information
>7e82 Chain 7 (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e82 Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R42 V44
Binding residue
(residue number reindexed from 1)		R41 V43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e82, PDBe:7e82, PDBj:7e82
PDBsum7e82
PubMed33882274
UniProtP16323|FLGF_SALTY Flagellar basal-body rod protein FlgF (Gene Name=flgF)

[Back to BioLiP]