Structure of PDB 7b0y Chain c Binding Site BS01

Receptor Information
>7b0y Chain c (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVE
Ligand information
>7b0y Chain a (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>..<
<<...<<<.<<<<<..........>>>>>.>>>...>>>..<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<<.
.>>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b0y Structure of a transcribing RNA polymerase II-U1 snRNP complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 S48 K50 M51 R52 G53 F56 Y86 A87 K88 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 S43 K45 M46 R47 G48 F51 Y81 A82 K83 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
GO:0042802 identical protein binding
GO:1990446 U1 snRNP binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0030532 small nuclear ribonucleoprotein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b0y, PDBe:7b0y, PDBj:7b0y
PDBsum7b0y
PubMed33446560
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]