Structure of PDB 7a23 Chain c Binding Site BS01

Receptor Information
>7a23 Chain c (length=99) Species: 3712 (Brassica oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLS
GIKPGIKGPSMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQK
Ligand information
>7a23 Chain n (length=27) Species: 3712 (Brassica oleracea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VSEDKNRNYAVVAGVVAIVGSIGWYLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a23 Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		L35 R36 T39 V45 Y49 G59 M62 Y76
Binding residue
(residue number reindexed from 1)		L34 R35 T38 V44 Y48 G58 M61 Y75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009853 photorespiration
Cellular Component
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a23, PDBe:7a23, PDBj:7a23
PDBsum7a23
PubMed33060577
UniProtQ84W12

[Back to BioLiP]