Structure of PDB 6giq Chain c Binding Site BS01

Receptor Information

>6giq Chain c (length=262) Species: 580240 (Saccharomyces cerevisiae W303)

RHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFV
LLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFW
AYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHH
ALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYA
GTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIW
LFLYVVFYWWGV

Ligand information

>6giq Chain g (length=29) Species: 580240 (Saccharomyces cerevisiae W303)

SALYLYPFYAIFAVAVVTPLLYIPNAIRG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6giq Cryo-EM structure of the yeast respiratory supercomplex.
• Resolution: 3.23 Å
• Binding residue (original residue number in PDB): S27 L30 T37 M50 V57 T60 L64 R67
• Binding residue (residue number reindexed from 1): S20 L23 T30 M43 V50 T53 L57 R60

Enzymatic activity

• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0009055 electron transfer activity
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0009060 aerobic respiration
• GO:0019646 aerobic electron transport chain
• GO:0022904 respiratory electron transport chain
• GO:0045333 cellular respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:6giq, PDBe:6giq, PDBj:6giq
• PDBsum: 6giq
• PubMed: 30598556
• UniProt: P00420|COX3_YEAST Cytochrome c oxidase subunit 3 (Gene Name=COX3)