Structure of PDB 4fby Chain c Binding Site BS01

Receptor Information
>4fby Chain c (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>4fby Chain m (length=28) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fby Room temperature femtosecond X-ray diffraction of photosystem II microcrystals.
Resolution6.56 Å
Binding residue
(original residue number in PDB)		P20 D23 V24 I28 L35
Binding residue
(residue number reindexed from 1)		P11 D14 V15 I19 L26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fby, PDBe:4fby, PDBj:4fby
PDBsum4fby
PubMed22665786
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]