Structure of PDB 9ci8 Chain b Binding Site BS01

Receptor Information
>9ci8 Chain b (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDPKLCYLLDGILFIYGVILTALFLRVKFSR
Ligand information
>9ci8 Chain a (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKLCYLLDGILFIYGVILTALFLRVKF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9ci8 T cell receptor complex
Resolution3.01 Å
Binding residue
(original residue number in PDB)		C32 L35 D36 L39 F40 Y42 L46 T47 F50 K54
Binding residue
(residue number reindexed from 1)		C6 L9 D10 L13 F14 Y16 L20 T21 F24 K28
External links
PDB RCSB:9ci8, PDBe:9ci8, PDBj:9ci8
PDBsum9ci8
PubMed
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]