Structure of PDB 8ro2 Chain b Binding Site BS01

Receptor Information
>8ro2 Chain b (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKAEREE
KRVLGLVLLRGENLVSMTVEGPPPKGAAGGPGIGRAAGRGIPAG
Ligand information
>8ro2 Chain 5 (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccgu
ggagaggaacaccaauuuuuugagccuugccuuggcaaggcu
<<<<<<<<<<<........<<<<<<<<.<.......>.>>>>>>>>...>
>>>>>>>>>>............<<<<<<<<....>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ro2 Mechanism for the initiation of spliceosome disassembly.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H37 E60 R73 G74 E75
Binding residue
(residue number reindexed from 1)		H32 E47 R60 G61 E62
External links
PDB RCSB:8ro2, PDBe:8ro2, PDBj:8ro2
PDBsum8ro2
PubMed38925148
UniProtP14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)

[Back to BioLiP]