Structure of PDB 8q7v Chain b Binding Site BS01

Receptor Information
>8q7v Chain b (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKREEKR
VLGLVLLRGENLVSMTVEGPPPK
Ligand information
>8q7v Chain 5 (length=104) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucugguuucucuucagaucgcauaaaucuuucgcacuaaagauuuccg
uggagaggaacaacucugaguccaauuuuuugaggccuugcuuuggcaag
gcua
<<<<.<<<<<<<<<<<<........<<<<<<<<......>>>>>>>>...
>>>>>>>>>>>....>.>>>>............<<<<<<<<....>>>>>
>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7v Structural basis of human U5 snRNP late biogenesis and recycling.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H37 K50
Binding residue
(residue number reindexed from 1)		H32 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0070034 telomerase RNA binding
GO:0070990 snRNP binding
GO:0071208 histone pre-mRNA DCP binding
GO:1990446 U1 snRNP binding
GO:1990447 U2 snRNP binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006479 protein methylation
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005683 U7 snRNP
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0005697 telomerase holoenzyme complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0034709 methylosome
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071204 histone pre-mRNA 3'end processing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7v, PDBe:8q7v, PDBj:8q7v
PDBsum8q7v
PubMed38467876
UniProtP14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)

[Back to BioLiP]