Structure of PDB 8ow1 Chain b Binding Site BS01

Receptor Information
>8ow1 Chain b (length=79) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYT
EHAKRKTVTSLDVVYALKRQGRTLYGFGG
Ligand information
>8ow1 Chain E (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcaatgaaatatatatttcttactatttcttttttaactttcggaaatc
aaatacactaatattaaaacgcgggggacagcgcgtacgtgcgtttaagc
ggtgctagagctgtctacgaccaattgagcggcctcggcaccatgtgact
tat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R36 R46 I47 R79 K80 T81
Binding residue
(residue number reindexed from 1)		R12 R22 I23 R55 K56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045943 positive regulation of transcription by RNA polymerase I
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow1, PDBe:8ow1, PDBj:8ow1
PDBsum8ow1
PubMed37506202
UniProtP02309|H4_YEAST Histone H4 (Gene Name=HHF1)

[Back to BioLiP]