Structure of PDB 8ovd Chain b Binding Site BS01

Receptor Information
>8ovd Chain b (length=149) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CSAGQISQTTTQEPAVNGVNAQAGQVSLRNVHLRAPQQTDYVEPGTTVEL
LFVAANDSTEGSNKLKSITSDVGEVTLTGDSTVPADGVLIVGEPDGQIAV
TAEVELTKPITNGLLYDFTFTFEDGETTVAVPISAGEQPRRPVPPAGPG
Ligand information
>8ovd Chain c (length=25) Species: 1772 (Mycolicibacterium smegmatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSPPGETASSEPGTTPAIWTGSPSP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovd Long-range charge transfer mechanism of the III 2 IV 2 mycobacterial supercomplex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D63 Y64
Binding residue
(residue number reindexed from 1)
D40 Y41
External links