Structure of PDB 8euj Chain b Binding Site BS01

Receptor Information
>8euj Chain b (length=92) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>8euj Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggaatccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euj Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		Y39 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		Y10 S23 S24 R54 S55 T56
External links