Structure of PDB 7zxe Chain b Binding Site BS01

Receptor Information
>7zxe Chain b (length=365) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFPEYELPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPAADSDREDAA
VARDLDCSLEAAAELRAVCGLDEVIPENTDLVTLGVRKRFLEHREETITI
DRACRQETFVYEMESHAIGKKPENSADMIEEGELILSVNILYPVIFHKHK
EHKPYQTMLVLGSQKLTQLRDSIRCVSDLQIGGEFSNTPDQAPEHISKDL
YKSAFFYFEGTFYNDKRYPECRDLSRTIIEWSESHDRGYGKFQTARMEDF
TFNDLCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKK
HWLWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKL
GEFLAYPYVDPGTFN
Ligand information
>7zxe Chain N (length=47) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgtgtgtgtaaagagtgaggcgtatgaggctgtgtcggggcagagg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zxe Structural basis of SNAPc-dependent snRNA transcription initiation by RNA polymerase II.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R140 I144 I146 C150 Q152 K194 H198 H347
Binding residue
(residue number reindexed from 1)		R94 I98 I100 C104 Q106 K148 H152 H301
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0005515 protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006383 transcription by RNA polymerase III
GO:0009301 snRNA transcription
GO:0042795 snRNA transcription by RNA polymerase II
GO:0042796 snRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0016604 nuclear body
GO:0019185 snRNA-activating protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zxe, PDBe:7zxe, PDBj:7zxe
PDBsum7zxe
PubMed36424526
UniProtQ92966|SNPC3_HUMAN snRNA-activating protein complex subunit 3 (Gene Name=SNAPC3)

[Back to BioLiP]