Structure of PDB 7qv3 Chain b Binding Site BS01

Receptor Information
>7qv3 Chain b (length=57) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKTVVRKNESLEDALRRFKRSVSKTGTLAEARKREFYEKPSVKRKKKSE
AARKRKF
Ligand information
>7qv3 Chain A (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauaaaugaugcagacaguacuagau
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qv3 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
Resolution5.14 Å
Binding residue
(original residue number in PDB)		E13 R17
Binding residue
(residue number reindexed from 1)		E13 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qv3, PDBe:7qv3, PDBj:7qv3
PDBsum7qv3
PubMed35264791
UniProtP21478|RS21_BACSU Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]