Structure of PDB 7b0y Chain b Binding Site BS01

Receptor Information
>7b0y Chain b (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIE
RRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVY
GPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV
DVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSG
Ligand information
>7b0y Chain a (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>..<
<<...<<<.<<<<<..........>>>>>.>>>...>>>..<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<<.
.>>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b0y Structure of a transcribing RNA polymerase II-U1 snRNP complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		P29 K32 H34 N35 Q36 Y38 R71 K74 R78 W89 D94 N96 A97 F106 A108 R109 V110 N111 Y112 H133 V135 K138 R139 R144 Y146 F148 R172 L175 E179 R180 G181 R182 P189 R190 R191 G195 L196 G197 T199 R200 R201
Binding residue
(residue number reindexed from 1)		P3 K6 H8 N9 Q10 Y12 R45 K48 R52 W63 D68 N70 A71 F80 A82 R83 V84 N85 Y86 H107 V109 K112 R113 R118 Y120 F122 R146 L149 E153 R154 G155 R156 P163 R164 R165 G169 L170 G171 T173 R174 R175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0043462 regulation of ATP-dependent activity
GO:0043484 regulation of RNA splicing
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0061084 negative regulation of protein refolding
GO:1904715 negative regulation of chaperone-mediated autophagy
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b0y, PDBe:7b0y, PDBj:7b0y
PDBsum7b0y
PubMed33446560
UniProtP08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa (Gene Name=SNRNP70)

[Back to BioLiP]