Structure of PDB 6qdv Chain b Binding Site BS01

Receptor Information
>6qdv Chain b (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFEKRVLGL
VLLRGENLVSMTVEGPPP
Ligand information
>6qdv Chain 5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccgu
ggagaggaacaaccaauuuuuugag
<<<<<<<<<<<........<<<<<<<<...........>>>>>>>>...>
>>>>>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		H37 N39 R73 G74
Binding residue
(residue number reindexed from 1)		H32 N34 R54 G55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtP14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)

[Back to BioLiP]