Structure of PDB 6b8h Chain b Binding Site BS01

Receptor Information
>6b8h Chain b (length=200) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDES
ILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVDRI
DSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSW
VRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSK
Ligand information
>6b8h Chain h (length=21) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b8h Atomic model for the dimeric FO region of mitochondrial ATP synthase.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		L172 V176
Binding residue
(residue number reindexed from 1)		L165 V169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
Biological Process
GO:0015986 proton motive force-driven ATP synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6b8h, PDBe:6b8h, PDBj:6b8h
PDBsum6b8h
PubMed29074581
UniProtP05626|ATPF_YEAST ATP synthase subunit 4, mitochondrial (Gene Name=ATP4)

[Back to BioLiP]