Structure of PDB 4y77 Chain b Binding Site BS01

Receptor Information

>4y77 Chain b (length=196) Species: 559292 (Saccharomyces cerevisiae S288C)

TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAA
DTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVA
GYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEE
TVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Ligand information

>4y77 Chain h (length=3) Species: 32630 (synthetic construct)

LAF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4y77 Systematic Analyses of Substrate Preferences of 20S Proteasomes Using Peptidic Epoxyketone Inhibitors.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): T1 T20 T21 T22 T31 K33 R45 G47 A49
• Binding residue (residue number reindexed from 1): T1 T20 T21 T22 T31 K33 R45 G47 A49

Enzymatic activity

• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0010499 proteasomal ubiquitin-independent protein catabolic process
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005839 proteasome core complex
• GO:0019774 proteasome core complex, beta-subunit complex
• GO:0034515 proteasome storage granule

External links

• PDB: RCSB:4y77, PDBe:4y77, PDBj:4y77
• PDBsum: 4y77
• PubMed: 26020686
• UniProt: P38624|PSB1_YEAST Proteasome subunit beta type-1 (Gene Name=PRE3)