Structure of PDB 7aor Chain aw Binding Site BS01

Receptor Information
>7aor Chain aw (length=160) Species: 353153 (Trypanosoma cruzi strain CL Brener) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISTGVFDHLPFQHRRQHAFNTLPLHDANHFGGRTAYLREIGPVNIKKSGR
RFKKDLRTVQFNVDIWCAQQTLRKRWKQRDWEVIEVPFRLAPAEQQRVIP
EMYTDVPPMTDPERHDFSNIRNKVYDREELQGVLFGASGPLPYPPLQRID
RQAMTLDKFL
Ligand information
>7aor Chain A (length=143) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uauuauauuuauucauauaauuaauaggauaauauuuguaguuuuugaua
ccaugauaaggauuauaaauugaaaguguuaauaucauaaucaaaauuua
uuauuuauauuaaauauguauguguagauaaaauaagaaauua
.......<<<<<......................................
..................................................
...........................>>>>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aor Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
F37 Q38 H39 R40 P49 L50 H51 D52 A53 G57 G58 A61 Y62 R64 E65 I66 P68 V69 N70 I71 K72 K73 S74 G75 R76 R77 K79 K80
Binding residue
(residue number reindexed from 1)
F11 Q12 H13 R14 P23 L24 H25 D26 A27 G31 G32 A35 Y36 R38 E39 I40 P42 V43 N44 I45 K46 K47 S48 G49 R50 R51 K53 K54
Enzymatic activity
Enzyme Commision number ?
External links