Structure of PDB 8tux Chain ab Binding Site BS01

Receptor Information
>8tux Chain ab (length=127) Species: 12023 (Pseudomonas phage PP7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAK
TAYRVNLKLDQADVVDCSTSVCGELPKVRYTQVWSHDVTIVANSTEASRK
SLYDLTKSLVATSQVEDLVVNLVPLGR
Ligand information
>8tux Chain R (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcgaaauggccuagaccaugccccuuggcaaacccauucgaccgggu
uugggucuucugaccucguaguccgcgcucagcggacuucgacca
<<<<<...<<<<......>>>>>>>>>.<<<.<<<<<<........>>>>
>>.<<<<....>>>><<<.<<<<<..<<...>>>>>>>.>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tux Removal of Pseudomonas Type IV Pili by a Small RNA Virus
Resolution3.9 Å
Binding residue
(original residue number in PDB)		I18 L75
Binding residue
(residue number reindexed from 1)		I18 L75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
Cellular Component
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tux, PDBe:8tux, PDBj:8tux
PDBsum8tux
PubMed38574145
UniProtP03630|CAPSD_BPPP7 Capsid protein

[Back to BioLiP]