Structure of PDB 6kmw Chain aC Binding Site BS01

Receptor Information

>6kmw Chain aC (length=80) Species: 1641165 (Halomicronema hongdechloris C2206)

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGSIASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 6kmw Chain aC Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kmw Structural basis for the adaptation and function of chlorophyll f in photosystem I.
• Resolution: 2.35 Å
• Binding residue (original residue number in PDB): C21 P22 V25 L26 C48 V49 G50 C51 K52 R53 C54 V67
• Binding residue (residue number reindexed from 1): C20 P21 V24 L25 C47 V48 G49 C50 K51 R52 C53 V66
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:6kmw, PDBe:6kmw, PDBj:6kmw
• PDBsum: 6kmw
• PubMed: 31932639
• UniProt: A0A1Z3HPE3