Structure of PDB 6qbx Chain a4 Binding Site BS01

Receptor Information
>6qbx Chain a4 (length=413) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENFNNLGTSHLL
RLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDIL
MEFLLNVTTAPEFRRWEVAALQSQLRIDKAVAFQNPQAHVIENLHAAAYR
NALANSLYCPDYRIGKVTPDELHDYVQNHFTSARMALIGLGVSHPVLKQV
AEQFLNIRAKAKYRGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQ
HVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYT
ISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSE
GFLDEVGCQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAA
SGNLGHTPFIDEL
Ligand information
>6qbx Chain x2 (length=26) Species: 9940 (Ovis aries) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qbx Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R70 L96 V98 T99 S100 Y177 F312 N313 Y368 E381
Binding residue
(residue number reindexed from 1)		R51 L77 V79 T80 S81 Y158 F286 N287 Y342 E355
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Apr 18 07:09:13 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6qbx', asym_id = 'a4', bs = 'BS01', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6qbx', asym_id='a4', bs='BS01', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004222,0006508,0046872', uniprot = '', pdbid = '6qbx', asym_id = 'a4'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004222,0006508,0046872', uniprot='', pdbid='6qbx', asym_id='a4')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>