Structure of PDB 8xr6 Chain a Binding Site BS01

Receptor Information

>8xr6 Chain a (length=334) Species: 173977 (Chroomonas placoidea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASAWERFCSWITSTDNRLYIGWFGVLMIPTLLTATTVYIIAFVAAPPVDI
DGIREPVAGSLLYGNNIITGAVIPSSASIGIHFYPIWEAASLDEWLYNGG
PYQLIVDHFLLGVCGWIGREWEFSYRLGMRPWISVAFTAPVAAASAVFLV
YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHQLGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESANYGYKFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRALHFFLGLWPVVGIWFTALGVMTMAFNLNGFNFNQSVVDSQ
GRVINTWADILNRANLGMEVMHERNAHNFPLDLA

Ligand information

>8xr6 Chain f (length=29) Species: 173977 (Chroomonas placoidea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TFRWLAIHGLAVPTVFFLGAITSMQFIQR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8xr6 Cryo-EM structure of cryptophyte photosystem II
Resolution	2.53 Å
Binding residue (original residue number in PDB)	V307 D308
Binding residue (residue number reindexed from 1)	V297 D298

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0015979	photosynthesis

	Cellular Component
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009536	plastid
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8xr6, PDBe:8xr6, PDBj:8xr6
PDBsum	8xr6
PubMed
UniProt	A0A222AI41

[Back to BioLiP]