Structure of PDB 8wk3 Chain a Binding Site BS01

Receptor Information
>8wk3 Chain a (length=133) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQV
DAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGE
MVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ
Ligand information
>8wk3 Chain b (length=13) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGVPGALSNQPAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wk3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state
Resolution3.3 Å
Binding residue
(original residue number in PDB)
L3 L4 N5 I6 D8
Binding residue
(residue number reindexed from 1)
L2 L3 N4 I5 D7
External links
PDB RCSB:8wk3, PDBe:8wk3, PDBj:8wk3
PDBsum8wk3
PubMed
UniProtP0A1I7|FLGC_SALTY Flagellar basal-body rod protein FlgC (Gene Name=flgC)

[Back to BioLiP]