Structure of PDB 8k25 Chain a Binding Site BS01

Receptor Information
>8k25 Chain a (length=81) Species: 979527 (Vibrio phage ICP1_2004_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFIRIKCFSKQPIAKKVSREVSAYLEYTGNNTWEGHISGQGVSNLQTKLI
NVGKGVKVVCNYQDKVLFAIGNVAMSDTGSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k25 Structure of Cas1-Cas2 complex bound dsDNA
Resolution3.4 Å
Binding residue
(original residue number in PDB)
F8 S9 K10 Y27 N30 N31
Binding residue
(residue number reindexed from 1)
F8 S9 K10 Y27 N30 N31
External links