Structure of PDB 7und Chain a Binding Site BS01

Receptor Information
>7und Chain a (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7und Chain N (length=120) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctgtctcgtgccttgttttccccttggcggttttttcgaaggggacagc
gcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcgg
cctcggcaccgggattctga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7und Structural basis of nucleosome retention during transcription elongation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 R42 T45 R63 R116 V117 T118
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 R5 T8 R26 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7und, PDBe:7und, PDBj:7und
PDBsum7und
PubMed35709268
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]