Structure of PDB 7fjf Chain a Binding Site BS01

Receptor Information
>7fjf Chain a (length=33) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVK
Ligand information
>7fjf Chain b (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLDPKLCYLLDGILFIYGVILTALFLRVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fjf Cholesterol inhibits TCR signaling by directly restricting TCR-CD3 core tunnel motility.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F24 C32 Y33 D36 L39 F40 L46 K54
Binding residue
(residue number reindexed from 1)		F3 C11 Y12 D15 L18 F19 L25 K33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fjf, PDBe:7fjf, PDBj:7fjf
PDBsum7fjf
PubMed35271814
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]