Structure of PDB 7dxa Chain a Binding Site BS01

Receptor Information
>7dxa Chain a (length=298) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDID
GIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGP
YQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIY
PIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALF
CAMHGSLVTSSLIRETTETNIVAAHGYFGRLISRSLHFFLAAWRVVGVWF
AALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHE
Ligand information
>7dxa Chain i (length=29) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
METLKITVYIVVTFFVLLFVFGFLSGDPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dxa Structural insights into cyanobacterial photosystem II intermediates associated with Psb28 and Tsl0063.
Resolution3.14 Å
Binding residue
(original residue number in PDB)		W32 F33 V35 I36 P39 I96 W97 E132
Binding residue
(residue number reindexed from 1)		W21 F22 V24 I25 P28 I85 W86 E121
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dxa, PDBe:7dxa, PDBj:7dxa
PDBsum7dxa
PubMed34226692
UniProtP51765|PSBA_THEVL Photosystem II protein D1 (Gene Name=psbA)

[Back to BioLiP]