Structure of PDB 6yn1 Chain a Binding Site BS01

Receptor Information
>6yn1 Chain a (length=89) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Ligand information
>6yn1 Chain Y (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PNEYDLNDSFLDDEEEDSDWEP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yn1 Crystal structure of histone chaperone APLF acidic domain bound to the histone H2A-H2B-H3-H4 octamer
Resolution2.35 Å
Binding residue
(original residue number in PDB)		A38 Y42 I54 S55 S56 K57 M59
Binding residue
(residue number reindexed from 1)		A4 Y8 I20 S21 S22 K23 M25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6yn1, PDBe:6yn1, PDBj:6yn1
PDBsum6yn1
PubMed35895815
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]