Structure of PDB 6nah Chain a Binding Site BS01

Receptor Information

>6nah Chain a (length=173) Species: 487 (Neisseria meningitidis)

DIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPG
GSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNS
RIMIHQPLISGGQASDIEIHARELLKIKEKLNRLMAKHCDRDLADLERDT
DRDNFMSAEEAKEYGLIDQILEN

Ligand information

>6nah Chain 3 (length=6) Species: 32630 (synthetic construct)

FTPKAK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6nah ClpP protease activation results from the reorganization of the electrostatic interaction networks at the entrance pores.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): E31 F65 Y67 L95 F117 L119 L196
• Binding residue (residue number reindexed from 1): E9 F43 Y45 L73 F95 L97 L171

Enzymatic activity

• Enzyme Commision number: 3.4.21.92: endopeptidase Clp.

Gene Ontology

Molecular Function

• GO:0004176 ATP-dependent peptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0008236 serine-type peptidase activity
• GO:0051117 ATPase binding

Biological Process

• GO:0006508 proteolysis
• GO:0006515 protein quality control for misfolded or incompletely synthesized proteins

Cellular Component

• GO:0005737 cytoplasm
• GO:0009368 endopeptidase Clp complex

External links

• PDB: RCSB:6nah, PDBe:6nah, PDBj:6nah
• PDBsum: 6nah
• PubMed: 31925204
• UniProt: Q9JZ38|CLPP_NEIMB ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)